chromatium

Summary

Summary: A genus of gram-negative, ovoid to rod-shaped bacteria that is phototrophic. All species use ammonia as a nitrogen source. Some strains are found only in sulfide-containing freshwater habitats exposed to light while others may occur in marine, estuarine, and freshwater environments.

Top Publications

  1. Viale A, Kobayashi H, Akazawa T, Henikoff S. rbcR [correction of rcbR], a gene coding for a member of the LysR family of transcriptional regulators, is located upstream of the expressed set of ribulose 1,5-bisphosphate carboxylase/oxygenase genes in the photosynthetic bacterium Chromatium vinos. J Bacteriol. 1991;173:5224-9 pubmed
    ..e., the ribulose 1,5-bisphosphate carboxylase genes expressed in the phototrophic purple bacterium Chromatium vinosum...
  2. Huber J, Gaillard J, Moulis J. NMR of Chromatium vinosum ferredoxin: evidence for structural inequivalence and impeded electron transfer between the two [4Fe-4S] clusters. Biochemistry. 1995;34:194-205 pubmed
    The 2[4Fe-4S] ferredoxin from Chromatium vinosum has been investigated by 1H and 13C nuclear magnetic resonance. 1H NMR sequence-specific assignments have been obtained for a large majority of the residues...
  3. Reinartz M, Tschäpe J, Brüser T, Truper H, Dahl C. Sulfide oxidation in the phototrophic sulfur bacterium Chromatium vinosum. Arch Microbiol. 1998;170:59-68 pubmed
    Sulfide oxidation in the phototrophic purple sulfur bacterium Chromatium vinosum D (DSMZ 180(T)) was studied by insertional inactivation of the fccAB genes, which encode flavocytochrome c, a protein that exhibits sulfide dehydrogenase ..
  4. Vergauwen B, Pauwels F, Jacquemotte F, Meyer T, Cusanovich M, Bartsch R, et al. Characterization of glutathione amide reductase from Chromatium gracile. Identification of a novel thiol peroxidase (Prx/Grx) fueled by glutathione amide redox cycling. J Biol Chem. 2001;276:20890-7 pubmed
    ..the central enzyme in glutathione amide cycling, glutathione amide reductase (GAR), has been isolated from Chromatium gracile, and its genomic organization has been examined...
  5. Viale A, Kobayashi H, Akazawa T. Expressed genes for plant-type ribulose 1,5-bisphosphate carboxylase/oxygenase in the photosynthetic bacterium Chromatium vinosum, which possesses two complete sets of the genes. J Bacteriol. 1989;171:2391-400 pubmed
    ..1,5-bisphosphate carboxylase/oxygenase (RuBisCO) were detected in the photosynthetic purple sulfur bacterium Chromatium vinosum by hybridization analysis with RuBisCO gene probes, cloned by using the lambda Fix vector, and ..
  6. Bagley K, Duin E, Roseboom W, Albracht S, Woodruff W. Infrared-detectable groups sense changes in charge density on the nickel center in hydrogenase from Chromatium vinosum. Biochemistry. 1995;34:5527-35 pubmed
    Fourier transform infrared studies of nickel hydrogenase from Chromatium vinosum reveal the presence of a set of three absorption bands in the 2100-1900 cm-1 spectral region...
  7. Bagley K, van Garderen C, Chen M, Duin E, Albracht S, Woodruff W. Infrared studies on the interaction of carbon monoxide with divalent nickel in hydrogenase from Chromatium vinosum. Biochemistry. 1994;33:9229-36 pubmed
    Infrared spectra of a carbon monoxy-bound form of the EPR silent Ni(II) species of hydrogenase isolated from Chromatium vinosum are presented. These spectra show a band at 2060 cm-1 due to v(CO) for a metal-CO complex...
  8. Dolata M, Van Beeumen J, Ambler R, Meyer T, Cusanovich M. Nucleotide sequence of the heme subunit of flavocytochrome c from the purple phototrophic bacterium, Chromatium vinosum. A 2.6-kilobase pair DNA fragment contains two multiheme cytochromes, a flavoprotein, and a homolog of human ankyrin. J Biol Chem. 1993;268:14426-31 pubmed
    The gene for the cytochrome subunit of Chromatium vinosum flavocytochrome c (sulfide dehydrogenase) was cloned from an EcoRI digest of chromosomal DNA...
  9. Moulis J. Molecular cloning and expression of the gene encoding Chromatium vinosum 2[4Fe-4S] ferredoxin. Biochim Biophys Acta. 1996;1308:12-4 pubmed
    The gene encoding Chromatium vinosum 2[4Fe-4S] ferredoxin has been cloned and expressed in Escherichia coli. It is flanked by a gene starting with the rare codon UUG and homologous to E. coli kdtB...

More Information

Publications131 found, 100 shown here

  1. Dahl C. Insertional gene inactivation in a phototrophic sulphur bacterium: APS-reductase-deficient mutants of Chromatium vinosum. Microbiology. 1996;142 ( Pt 12):3363-72 pubmed
    ..of the genes encoding the adenylylsulphate-forming enzyme adenosine-5'-phosphosulphate (APS) reductase from Chromatium vinosum strain D (DSM 180'), a representative of the purple sulphur bacteria, and the construction of mutations ..
  2. Müh U, Sinskey A, Kirby D, Lane W, Stubbe J. PHA synthase from chromatium vinosum: cysteine 149 is involved in covalent catalysis. Biochemistry. 1999;38:826-37 pubmed
    Polyhydroxyalkanoate synthase (PHA) from Chromatium vinosum catalyzes the conversion of 3-hydroxybutyryl-CoA (HB-CoA) to polyhydroxybutyrate (PHB) and CoA...
  3. Kyritsis P, Kümmerle R, Huber J, Gaillard J, Guigliarelli B, Popescu C, et al. Unusual NMR, EPR, and Mössbauer properties of Chromatium vinosum 2[4Fe-4S] ferredoxin. Biochemistry. 1999;38:6335-45 pubmed
    The ferredoxin from Chromatium vinosum (CvFd) exhibits sequence and structure peculiarities...
  4. Davidson G, Choudhury S, Gu Z, Bose K, Roseboom W, Albracht S, et al. Structural examination of the nickel site in chromatium vinosum hydrogenase: redox state oscillations and structural changes accompanying reductive activation and CO binding. Biochemistry. 2000;39:7468-79 pubmed
    An X-ray absorption spectroscopic study of structural changes occurring at the Ni site of Chromatium vinosum hydrogenase during reductive activation, CO binding, and photolysis is presented...
  5. Toropygina O, Makhneva Z, Moskalenko A. Reconstitution of carotenoids into the light-harvesting complex B800-850 of Chromatium minutissimum. Biochemistry (Mosc). 2003;68:901-11 pubmed
    Chromatophores and peripheral light-harvesting complexes B800-850 with a trace of carotenoids were isolated from Chromatium minutissimum cells in which carotenoid biosynthesis was inhibited by diphenylamine...
  6. Liebergesell M, Schmidt B, Steinbuchel A. Isolation and identification of granule-associated proteins relevant for poly(3-hydroxyalkanoic acid) biosynthesis in Chromatium vinosum D. FEMS Microbiol Lett. 1992;78:227-32 pubmed
    ..proteins as revealed by SDS polyacrylamide gel electrophoresis, were isolated from crude cellular extracts of Chromatium vinosum D by centrifugation in a linear sucrose gradient...
  7. Van Beeumen J, Demol H, Samyn B, Bartsch R, Meyer T, Dolata M, et al. Covalent structure of the diheme cytochrome subunit and amino-terminal sequence of the flavoprotein subunit of flavocytochrome c from Chromatium vinosum. J Biol Chem. 1991;266:12921-31 pubmed
    ..sequence of the 21-kDa cytochrome subunit of the flavocytochrome c (FC) from the purple phototrophic bacterium Chromatium vinosum has been determined to be as follows: EPTAEMLTNNCAGCHG THGNSVGPASPSIAQMDPMVFVEVMEGFKSGEIAS ..
  8. Meissner J, Pfennig N, Krauss J, Mayer H, Weckesser J. Lipopolysaccharides of Thiocystis violacea, Thiocapsa pfennigii, and Chromatium tepidum, species of the family Chromatiaceae. J Bacteriol. 1988;170:3217-22 pubmed
    ..bacteria (Chromatiaceae), Thiocystis violacea, Thiocapsa pfennigii, and the moderately thermophilic bacterium Chromatium tepidum, were isolated...
  9. Liebergesell M, Sonomoto K, Madkour M, Mayer F, Steinbuchel A. Purification and characterization of the poly(hydroxyalkanoic acid) synthase from Chromatium vinosum and localization of the enzyme at the surface of poly(hydroxyalkanoic acid) granules. Eur J Biochem. 1994;226:71-80 pubmed
    A recombinant strain of Escherichia coli, which overexpressed phaC and phaE from Chromatium vinosum, was used to isolate poly(3-hydroxyalkanoic acid) synthase...
  10. Garcia Castillo M, Lou B, Ondrias M, Robertson D, Knaff D. Characterization of flavocytochrome C552 from the thermophilic photosynthetic bacterium Chromatium tepidum. Arch Biochem Biophys. 1994;315:262-6 pubmed
    A M(r) 68 kDa flavocytochrome c552 has been isolated from the thermophilic photosynthetic purple sulfur bacterium Chromatium tepidum and shown to consist of a M(r) 25 kDa subunit that contains two covalently bound heme c and a M(r) 43 kDa ..
  11. Moulis J, Sieker L, Wilson K, Dauter Z. Crystal structure of the 2[4Fe-4S] ferredoxin from Chromatium vinosum: evolutionary and mechanistic inferences for [3/4Fe-4S] ferredoxins. Protein Sci. 1996;5:1765-75 pubmed
    The crystal structure of the 2[4Fe-4S] ferredoxin from Chromatium vinosum has been solved by molecular replacement using data recorded with synchrotron radiation...
  12. Kyritsis P, Hatzfeld O, Link T, Moulis J. The two [4Fe-4S] clusters in Chromatium vinosum ferredoxin have largely different reduction potentials. Structural origin and functional consequences. J Biol Chem. 1998;273:15404-11 pubmed
    The 2[4Fe-4S] ferredoxin from Chromatium vinosum arises as one prominent member of a recently defined family of proteins found in very diverse bacteria...
  13. Pott A, Dahl C. Sirohaem sulfite reductase and other proteins encoded by genes at the dsr locus of Chromatium vinosum are involved in the oxidation of intracellular sulfur. Microbiology. 1998;144 ( Pt 7):1881-94 pubmed
    The sequence of the dsr gene region of the phototrophic sulfur bacterium Chromatium vinosum D (DSMZ 180) was determined to clarify the in vivo role of 'reverse' sirohaem sulfite reductase...
  14. Happe R, Roseboom W, Albracht S. Pre-steady-state kinetics of the reactions of [NiFe]-hydrogenase from Chromatium vinosum with H2 and CO. Eur J Biochem. 1999;259:602-8 pubmed
    Results are presented of the first rapid-mixing/rapid-freezing studies with a [NiFe]-hydrogenase. The enzyme from Chromatium vinosum was used. In particular the reactions of active enzyme with H2 and CO were monitored...
  15. Jia Y, Kappock T, Frick T, Sinskey A, Stubbe J. Lipases provide a new mechanistic model for polyhydroxybutyrate (PHB) synthases: characterization of the functional residues in Chromatium vinosum PHB synthase. Biochemistry. 2000;39:3927-36 pubmed
    ..A protein BLASTp search using the Class III Chromatium vinosum synthase sequence reveals high homology to prokaryotic lipases whose crystal structures are known...
  16. Fry B, Gest H, Hayes J. Isotope effects associated with the anaerobic oxidation of sulfite and thiosulfate by the photosynthetic bacterium, Chromatium vinosum. FEMS Microbiol Lett. 1985;27:227-32 pubmed
    The purple photosynthetic bacterium Chromatium vinosum, strain D, catalyzes several oxidations of reduced sulfur compounds under anaerobic conditions in the light: e.g...
  17. Johnson T, Yee B, Carlson D, Buchanan B, Johnson R, Mathews W, et al. Thioredoxin from Rhodospirillum rubrum: primary structure and relation to thioredoxins from other photosynthetic bacteria. J Bacteriol. 1988;170:2406-8 pubmed
    ..thioredoxin to Escherichia coli thioredoxin was intermediate to those of the Chlorobium thiosulfatophilum and Chromatium vinosum proteins. The results indicate that R...
  18. Banci L, Bertini I, Dikiy A, Kastrau D, Luchinat C, Sompornpisut P. The three-dimensional solution structure of the reduced high-potential iron-sulfur protein from Chromatium vinosum through NMR. Biochemistry. 1995;34:206-19 pubmed
    The 1H NMR assignment of the reduced HiPIP from Chromatium vinosum available in the literature [Gaillard, J., Albrand, J.-P., Moulis, J.-M., & Wemmer, D. E...
  19. Brune D. Isolation and characterization of sulfur globule proteins from Chromatium vinosum and Thiocapsa roseopersicina. Arch Microbiol. 1995;163:391-9 pubmed
    ..The proteins associated with sulfur globules of Chromatium vinosum and Thiocapsa roseopersicina were isolated by extraction into 50% aqueous acetonitrile containing 1% ..
  20. Hipp W, Pott A, Thum Schmitz N, Faath I, Dahl C, Truper H. Towards the phylogeny of APS reductases and sirohaem sulfite reductases in sulfate-reducing and sulfur-oxidizing prokaryotes. Microbiology. 1997;143 ( Pt 9):2891-902 pubmed
    ..APS) reductase, aprBA, and sirohaem sulfite reductase, dsrAB, from the sulfur-oxidizing phototrophic bacterium Chromatium vinosum strain D (DSMZ 180(T)) were cloned and sequenced...
  21. Gilmour R, Goodhew C, Pettigrew G. Cytochrome c' of Paracoccus denitrificans. Biochim Biophys Acta. 1991;1059:233-8 pubmed
    ..Comparison of the amino-acid compositions suggests some similarity to the cytochromes c' of Chromatium vinosum and halotolerant Paracoccus.
  22. Razjivin A, Moskalenko A, Novoderezhkin V. Model of detergent-induced spectral changes of the B800-850 complex from Chromatium minutissimum. IUBMB Life. 2000;50:115-7 pubmed
    The absorption and circular dichroism spectra of the B800-850 complex from Chromatium minutissimum before and after the Triton X-100 treatment were simulated by means of standard exciton theory, taking into account inhomogeneous ..
  23. Meyer T, Bartsch R, Cusanovich M. Adduct formation between sulfite and the flavin of phototrophic bacterial flavocytochromes c. Kinetics of sequential bleach, recolor, and rebleach of flavin as a function of pH. Biochemistry. 1991;30:8840-5 pubmed
    ..of sulfite adduct formation with the bound flavin in flavocytochromes c from the purple phototrophic bacterium Chromatium vinosum and the green phototrophic bacterium Chlorobium thiosulfatophilum have been investigated as a function ..
  24. Sundquist A, Fahey R. Evolution of antioxidant mechanisms: thiol-dependent peroxidases and thioltransferase among procaryotes. J Mol Evol. 1989;29:429-35 pubmed
    ..work that representatives from these two groups (Escherichia coli, Beneckea alginolytica, Rhodospirillum rubrum, Chromatium vinosum, and Anabaena sp...
  25. Krasil nikova E, Zakharchuk L. [The activity of the carbon metabolism enzymes in Chromatium minutissimum after long-term preservation]. Mikrobiologiia. 2000;69:328-33 pubmed
    ..as well as of some enzymes involved in carbohydrate metabolism, were determined in the purple sulfur bacterium Chromatium minutissimum, either maintained by subculturing in liquid medium or stored in the lyophilized state for 36 years...
  26. Cowan J, Sola M. 1H NMR studies of oxidized high-potential iron protein from Chromatium vinosum. Nuclear Overhauser effect measurements. Biochemistry. 1990;29:5633-7 pubmed
    1H nuclear Overhauser effect experiments on the isotropically shifted signals of oxidized Chromatium vinosum HiPIP have been used to identify the four beta-CH2 geminal couples of the cysteine ligands...
  27. Meyer T, Bartsch R, Cusanovich M, Tollin G. Kinetics of photooxidation of soluble cytochromes, HiPIP, and azurin by the photosynthetic reaction center of the purple phototrophic bacterium Rhodopseudomonas viridis. Biochemistry. 1993;32:4719-26 pubmed
    ..Other cytochromes c2 are intermediate in reactivity. More distantly related cytochromes, HiPIP, and azurin are relatively poor electron donors under the conditions of assay.(ABSTRACT TRUNCATED AT 250 WORDS) ..
  28. Li D, Cottrell C, Cowan J. 15N resonance assignments of oxidized and reduced Chromatium vinosum high-potential iron protein. J Protein Chem. 1995;14:115-26 pubmed
    The 15N resonances in reduced and oxidized Chromatium vinosum high-potential iron protein have been assigned by use of 1H-1H COSY spectra and 1H-15N HMQC. HMQC-COSY, and HMQC-NOESY spectra...
  29. Jensen G, Warshel A, Stephens P. Calculation of the redox potentials of iron-sulfur proteins: the 2-/3-couple of [Fe4S*4Cys4] clusters in Peptococcus aerogenes ferredoxin, Azotobacter vinelandii ferredoxin I, and Chromatium vinosum high-potential iron protein. Biochemistry. 1994;33:10911-24 pubmed
    ..iron-sulfur proteins Peptococcus aerogenes ferredoxin (PaFd), Azotobacter vinelandii ferredoxin I (AvFdI) and Chromatium vinosum high potential iron protein (CvHiPIP) based on the Protein Dipoles Langevin Dipoles (PDLD) method are ..
  30. Crawford N, Sutton C, Yee B, Johnson T, Carlson D, Buchanan B. Contrasting modes of photosynthetic enzyme regulation in oxygenic and anoxygenic prokaryotes. Arch Microbiol. 1984;139:124-9 pubmed
    ..The corresponding enzymes from Chromatium vinosum, an anoxygenic photosynthetic purple bacterium found recently to contain the NADP/thioredoxin system, ..
  31. Nozawa T, Trost J, Fukada T, Hatano M, McManus J, Blankenship R. Properties of the reaction center of the thermophilic purple photosynthetic bacterium Chromatium tepidum. Biochim Biophys Acta. 1987;894:468-76 pubmed
    Reaction centers were purified from the thermophilic purple sulfur photosynthetic bacterium Chromatium tepidum...
  32. van der Spek T, Arendsen A, Happe R, Yun S, Bagley K, Stufkens D, et al. Similarities in the architecture of the active sites of Ni-hydrogenases and Fe-hydrogenases detected by means of infrared spectroscopy. Eur J Biochem. 1996;237:629-34 pubmed
    ..that absorb in the 2100-1800-cm-1 infrared spectral region have recently been detected in Ni-hydrogenase from Chromatium vinosum [Bagley, K.A., Duin, E.C., Roseboom, W., Albracht, S. P.J. & Woodruff, W.H...
  33. Boll M, Fuchs G, Tilley G, Armstrong F, Lowe D. Unusual spectroscopic and electrochemical properties of the 2[4Fe-4S] ferredoxin of Thauera aromatica. Biochemistry. 2000;39:4929-38 pubmed
    ..It contains two [4Fe-4S] clusters and belongs to the Chromatium vinosum type of ferredoxins (CvFd) which differ from the "clostridial" type by a six-amino acid ..
  34. Tonolla M, Peduzzi R, Hahn D. Long-term population dynamics of phototrophic sulfur bacteria in the chemocline of Lake Cadagno, Switzerland. Appl Environ Microbiol. 2005;71:3544-50 pubmed
    ..populations belonging to the genus Lamprocystis being numerically much more important than those of the genera Chromatium and Thiocystis...
  35. Bertini I, Dikiy A, Kastrau D, Luchinat C, Sompornpisut P. Three-dimensional solution structure of the oxidized high potential iron-sulfur protein from Chromatium vinosum through NMR. Comparative analysis with the solution structure of the reduced species. Biochemistry. 1995;34:9851-8 pubmed
    The NMR solution structure of the oxidized HiPIP from Chromatium vinosum has been solved. Despite the fact that the protein is paramagnetic, 85% of the 1H and 80% of the 15N signals have been assigned...
  36. Vazquez G, Wieczoreck R, Steinbuchel A, Mendez B. [Poly-(3-hydroxybutyrate) granules in Bacillus megaterium. Isolation and analysis of associated proteins]. Rev Argent Microbiol. 1996;28:118-22 pubmed
    ..megaterium PV447 and the analysis by polyacrylamide gel electrophoresis of the associated proteins. By comparison with another species a function is proposed for some of these proteins. ..
  37. Lehmann T, Luchinat C, Piccioli M. Redox-related chemical shift perturbations on backbone nuclei of high-potential iron-sulfur proteins. Inorg Chem. 2002;41:1679-83 pubmed
  38. Franz B, Gehrke T, Lichtenberg H, Hormes J, Dahl C, Prange A. Unexpected extracellular and intracellular sulfur species during growth of Allochromatium vinosum with reduced sulfur compounds. Microbiology. 2009;155:2766-74 pubmed publisher
    ..It therefore seems unlikely that mobilization of elemental sulfur by purple sulfur bacteria involves excretion of soluble sulfur-containing substances that would be able to act on substrate distant from the cells. ..
  39. Kobayashi H, Viale A, Takabe T, Akazawa T, Wada K, Shinozaki K, et al. Sequence and expression of genes encoding the large and small subunits of ribulose 1,5-bisphosphate carboxylase/oxygenase from Chromatium vinosum. Gene. 1991;97:55-62 pubmed
    ..1,5-bisphosphate carboxylase/oxygenase (RuBisCO) was cloned from the photosynthetic purple sulfur bacterium Chromatium vinosum...
  40. Nettesheim D, Harder S, Feinberg B, Otvos J. Sequential resonance assignments of oxidized high-potential iron-sulfur protein from Chromatium vinosum. Biochemistry. 1992;31:1234-44 pubmed
    2D NMR spectra of the high-potential iron-sulfur protein (HiPIP) from Chromatium vinosum have been used to obtain partial resonance assignments for the oxidized paramagnetic redox state of the protein...
  41. Bertini I, Briganti F, Monnanni R, Scozzafava A, Carlozzi P, Materassi R. 1H NMR studies of Chromatium vinosum cytochrome c'. Arch Biochem Biophys. 1990;282:84-90 pubmed
    The cytochrome c' from Chromatium vinosum has been studied through 1H NMR in the pH range 4-11 in both the oxidized and the reduced forms. The 1H NMR spectra are similar to those of the other cytochrome c' systems. Three pKa values of 5...
  42. Swartz P, Beck B, Ichiye T. Structural origins of redox potentials in Fe-S proteins: electrostatic potentials of crystal structures. Biophys J. 1996;71:2958-69 pubmed
  43. Bertini I, Cowan J, Luchinat C, Natarajan K, Piccioli M. Characterization of a partially unfolded high potential iron protein. Biochemistry. 1997;36:9332-9 pubmed
    A partially unfolded state of the Fe4S4-containing high potential iron-sulfur protein from Chromatium vinosum has been detected and characterized by NMR spectroscopy following addition of a concentrated solution of guanidinium chloride to ..
  44. Jossek R, Steinbuchel A. In vitro synthesis of poly(3-hydroxybutyric acid) by using an enzymatic coenzyme A recycling system. FEMS Microbiol Lett. 1998;168:319-24 pubmed
    Purified recombinant poly(hydroxyalkanoic acid), PHA, synthase from Chromatium vinosum was used to examine in vitro poly(3-hydroxybutyric acid) (P(3HB)) formation...
  45. Vergauwen B, Van Petegem F, Remaut H, Pauwels F, Van Beeumen J. Crystallization and preliminary X-ray crystallographic analysis of glutathione amide reductase from Chromatium gracile. Acta Crystallogr D Biol Crystallogr. 2002;58:339-40 pubmed
    ..Crystals of the GAR enzyme from Chromatium gracile have been grown at 294 K by the hanging-drop vapour-diffusion method using lithium sulfate as a ..
  46. Krikunova M, Leupold D, Rini M, Voigt B, Moskalenko A, Toropygina O, et al. [Two-photon excitation fluorescence spectrum of the light-harvesting complex LH2 from Chromatium minutissimum within 650-745 nm range is determined by two-photon absorption of bacteriochlorophyll rather than of carotenoids]. Biofizika. 2002;47:1015-20 pubmed
    ..excitation spectra of the peripheral light-harvesting complex LH2 from the purple photosynthetic bacterium Chromatium minutissimum were examined within the expected spectral range of the optically forbidden S1 singlet state of ..
  47. Brown J, Haas E, James B, Hunt D, Liu J, Pace N. Phylogenetic analysis and evolution of RNase P RNA in proteobacteria. J Bacteriol. 1991;173:3855-63 pubmed
    ..Phylogenetic comparisons indicate that these sequences are not homologous and that any similarity in the structures is, at best, tenuous. ..
  48. Sola M, Cowan J, Gray H. 1H NMR characterization of Chromatium gracile high-potential iron protein and its ruthenium-modified derivatives. Modulation of the reduction potentials in low- and high-potential [Fe4S4] ferredoxins. Biochemistry. 1989;28:5261-8 pubmed
    The NMR spectra of the high-potential iron protein from the photosynthetic bacterium Chromatium gracile and its ruthenium-labeled (His-42 and His-20) derivatives are reported...
  49. Dilg A, Capozzi F, Mentler M, Iakovleva O, Luchinat C, Bertini I, et al. Comparison and characterization of the [Fe4S4]2+/3+ centre in the wild-type and C77S mutated HiPIPs from Chromatium vinosum monitored by Mössbauer, 57Fe ENDOR and EPR spectroscopies. J Biol Inorg Chem. 2001;6:232-46 pubmed
    ..reduced and the oxidized high-potential iron proteins (HiPIPs) of the wild type (WT) and the C77S mutant from Chromatium vinosum...
  50. Krikunova M, Kummrow A, Voigt B, Rini M, Lokstein H, Moskalenko A, et al. Fluorescence of native and carotenoid-depleted LH2 from Chromatium minutissimum, originating from simultaneous two-photon absorption in the spectral range of the presumed (optically 'dark') S(1) state of carotenoids. FEBS Lett. 2002;528:227-9 pubmed
    ..In conclusion, comparison to carotenoid-depleted samples is a conditio sine qua non for unambiguous interpretation of similar experiments. ..
  51. Godik V, Timpmann K, Freiberg A, Moskalenko A. Picosecond dynamics of excitations in light-harvesting complex B800-850 from Chromatium minutissimum studied using fluorescence spectrochronography. FEBS Lett. 1993;327:68-70 pubmed
    ..dynamics of excitations in the isolated B800-850 light-harvesting complex of the purple sulfur bacterium Chromatium minutissimum has been studied using picosecond fluorescence spectrochronography...
  52. Fahey R, Buschbacher R, Newton G. The evolution of glutathione metabolism in phototrophic microorganisms. J Mol Evol. 1987;25:81-8 pubmed
    ..Substantial levels of GSH were present in the purple bacteria (Chromatium vinosum, Rhodospirillum rubrum, Rhodobacter sphaeroides, and Rhodocyclus gelatinosa), the cyanobacteria [..
  53. La Mar G, Jackson J, Dugad L, Cusanovich M, Bartsch R. Proton NMR study of the comparative electronic/magnetic properties and dynamics of the acid in equilibrium with alkaline transition in a series of ferricytochromes c'. J Biol Chem. 1990;265:16173-80 pubmed
    ..of ferricytochrome c' from Rhodopseudomonas palustris, Rhodospirillum molischianum, Rhodospirillum rubrum, and Chromatium vinosum have been investigated for the purpose of further elucidating the common spectral and/or structural ..
  54. Valle E, Kobayashi H, Akazawa T. Transcriptional regulation of genes for plant-type ribulose-1,5-bisphosphate carboxylase/oxygenase in the photosynthetic bacterium, Chromatium vinosum. Eur J Biochem. 1988;173:483-9 pubmed
    ..of ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) in the photosynthetic purple sulfur bacterium, Chromatium vinosum, grown either heterotrophically or autotrophically, was highly correlated with the level of 2...
  55. Agarwal A, Li D, Cowan J. Role of aromatic residues in stabilization of the [Fe4S4] cluster in high-potential iron proteins (HiPIPs): physical characterization and stability studies of Tyr-19 mutants of Chromatium vinosum HiPIP. Proc Natl Acad Sci U S A. 1995;92:9440-4 pubmed
    The functional role of residue Tyr-19 of Chromatium vinosum HiPIP has been evaluated by site-directed mutagenesis experiments. The stability of the [Fe4S4] cluster prosthetic center is sensitive to side-chain replacements...
  56. Vermeglio A, Li J, Schoepp Cothenet B, Pratt N, Knaff D. The role of high-potential iron protein and cytochrome c(8) as alternative electron donors to the reaction center of Chromatium vinosum. Biochemistry. 2002;41:8868-75 pubmed
    Under anaerobic conditions, intact cells of the purple sulfur bacterium Chromatium vinosum exhibit rapid photooxidation of the two low-potential hemes of the c-type cytochrome associated with the reaction center, after exposure to two ..
  57. Thiemann B, Imhoff J. Occurrence and purification of the photoactive yellow protein of Ectothiorhodospira halophila (PYP) and of immunologically related proteins of Rhodospirillum salexigens and Chromatium salexigens and intracellular localization of PYP. Biochim Biophys Acta. 1995;1253:181-8 pubmed
    ..8 kDa) was only found in the strains of E. halophila. Additionally, two soluble proteins of Chromatium salexigens and Rhodospirillum salexigens (apparent molecular masses 16...
  58. Esteve I, Mas J, Gaju N, Guerrero R. Cellular content of storage inclusions in purple sulfur bacteria determined by ultrathin sections. Microbiologia. 1996;12:563-70 pubmed
    ..The results indicate that, in natural environments, cells have an extremely high content of storage inclusions, much higher than their laboratory grown counterparts, probably as a consequence of less favorable environmental conditions. ..
  59. Chamorovsky S, Zakharova N, Remennikov S, Sabo Y, Rubin A. The cytochrome subunit structure in the photosynthetic reaction center of Chromatium minutissimum. FEBS Lett. 1998;422:231-4 pubmed
    Gel-electrophoretic assay revealed that the photosynthetic reaction center (RC) of Chromatium minutissimum, in contrast to the well-known RC Rhodopseudomonas viridis, consists of five rather than four subunits with molecular masses of 37, ..
  60. Sanchez O, Mas J. Kinetics of photoacclimation in cultures of Chromatium vinosum DSM 185 during shifts in light irradiance. Microbiology. 1999;145 ( Pt 4):827-33 pubmed
    Continuous cultures of Chromatium vinosum DSM 185 were shifted from a high to a low irradiance (67 to 4 microE m(-2) s(-1)) and vice versa (4 to 67 microE m(-2) s(-1))...
  61. Hase T, Wakabayashi S, Matsubara H. Pseudomonas ovalis ferredoxin: similarity to Azotobacter and Chromatium ferredoxins. FEBS Lett. 1978;91:315-9 pubmed
  62. LaGrandeur T, Huttenhofer A, Noller H, Pace N. Phylogenetic comparative chemical footprint analysis of the interaction between ribonuclease P RNA and tRNA. EMBO J. 1994;13:3945-52 pubmed
    ..Analyses were carried out with RNase P RNAs from three different bacteria: Escherichia coli, Chromatium vinosum and Bacillus subtilis...
  63. Garcia Castillo M, Finnegan M, Conover R, Knaff D, Johnson M. Spectroscopic characterization of flavocytochrome c-552 from the photosynthetic purple sulfur bacterium Chromatium vinosum. Biochim Biophys Acta. 1994;1184:273-8 pubmed
    ..ligands to the two hemes of the flavocytochrome c-552 isolated from the photosynthetic purple sulfur bacterium Chromatium vinosum have been investigated by visible/near-infrared absorption and magnetic circular dichroism (MCD) ..
  64. Jossek R, Reichelt R, Steinbuchel A. In vitro biosynthesis of poly(3-hydroxybutyric acid) by using purified poly(hydroxyalkanoic acid) synthase of Chromatium vinosum. Appl Microbiol Biotechnol. 1998;49:258-66 pubmed
    Purified recombinant poly(hydroxyalkanoic acid) (PHA) synthase from Chromatium vinosum (PhaECCv) was used to examine in vitro the specific synthase activity, turnover of R-(-)-3-hydroxybutyryl coenzyme A (3HB-CoA) and poly(3-..
  65. Parisini E, Capozzi F, Lubini P, Lamzin V, Luchinat C, Sheldrick G. Ab initio solution and refinement of two high-potential iron protein structures at atomic resolution. Acta Crystallogr D Biol Crystallogr. 1999;55:1773-84 pubmed
    The crystal structure of the reduced high-potential iron protein (HiPIP) from Chromatium vinosum has been redetermined in a new orthorhombic crystal modification, and the structure of its H42Q mutant has been determined in orthorhombic (..
  66. Permentier H, Neerken S, Schmidt K, Overmann J, Amesz J. Energy transfer and charge separation in the purple non-sulfur bacterium Roseospirillum parvum. Biochim Biophys Acta. 2000;1460:338-45 pubmed
  67. Katayama N, Kobayashi M, Motojima F, Inaka K, Nozawa T, Miki K. Preliminary X-ray crystallographic studies of photosynthetic reaction center from a thermophilic sulfur bacterium, Chromatium tepidum. FEBS Lett. 1994;348:158-60 pubmed
    ..A membrane protein complex, photosynthetic reaction center purified from the thermophilic purple sulfur bacterium, Chromatium tepidum has been crystallized from a phosphate buffer containing a detergent, n-octyl-beta-D-glucopyranoside and ..
  68. Ren Z, Meyer T, McRee D. Atomic structure of a cytochrome c' with an unusual ligand-controlled dimer dissociation at 1.8 A resolution. J Mol Biol. 1993;234:433-45 pubmed
    The crystallographic structure of cytochrome c' from the purple phototrophic bacterium Chromatium vinosum (CVCP) has been determined at 1.8 A resolution using multiple isomorphous replacement...
  69. Novoderezhkin V, Razjivin A. Excitonic interactions in the light-harvesting antenna of photosynthetic purple bacteria and their influence on picosecond absorbance difference spectra. FEBS Lett. 1993;330:5-7 pubmed
    ..In particular, the absorption changes with high amplitude of bleaching at the long-wavelength side of the absorption band at different excitation energy are predicted. ..
  70. Babini E, Borsari M, Capozzi F, Eltis L, Luchinat C. Experimental evidence for the role of buried polar groups in determining the reduction potential of metalloproteins: the S79P variant of Chromatium vinosum HiPIP. J Biol Inorg Chem. 1999;4:692-700 pubmed
    The amide group between residues 78 and 79 of Chromatium vinosum high-potential iron-sulfur protein (HiPIP) is in close proximity to the Fe4S4 cluster of this protein and interacts via a hydrogen bond with S gamma of Cys77, one of the ..
  71. Polli D, Cerullo G, Lanzani G, De Silvestri S, Hashimoto H, Cogdell R. Carotenoid-bacteriochlorophyll energy transfer in LH2 complexes studied with 10-fs time resolution. Biophys J. 2006;90:2486-97 pubmed
    ..In the case of okenone in the LH2 complex from Chromatium purpuratum, we obtained an energy transfer efficiency of etaET2=63+/-2...
  72. Nozawa T, Madigan M. Temperature and solvent effects on reaction centers from Chloroflexus aurantiacus and Chromatium tepidum. J Biochem. 1991;110:588-94 pubmed
    ..center structures were examined in two thermophilic photosynthetic bacteria, Chloroflexus aurantiacus and Chromatium tepidum, in order to gain insight into the interactions among the reaction center proteins and pigment systems...
  73. Grant Burgess J, Miyashita H, Sudo H, Matsunaga T. Antibiotic production by the marine photosynthetic bacterium Chromatium purpuratum NKPB 031704: localization of activity to the chromatophores. FEMS Microbiol Lett. 1991;68:301-5 pubmed
    ..Two strains showed antibiotic activity towards Saccharomyces cerevisiae and were tentatively identified as Chromatium purpuratum. Crude antibiotic, prepared by solvent extraction, showed a broad antimicrobial spectrum...
  74. Shimada A, Kanai S, Maruyama T. Partial sequence of ribulose-1,5-bisphosphate carboxylase/oxygenase and the phylogeny of Prochloron and Prochlorococcus (Prochlorales). J Mol Evol. 1995;40:671-7 pubmed
    ..and Prochloron, indicate that Prochlorococcus is more closely related to a photosynthetic bacterium, Chromatium vinosum (gamma-purple bacteria), than to cyanobacteria, while Prochloron is closely related to the ..
  75. Brüser T, Deutzmann R, Dahl C. Evidence against the double-arginine motif as the only determinant for protein translocation by a novel Sec-independent pathway in Escherichia coli. FEMS Microbiol Lett. 1998;164:329-36 pubmed
    ..was studied by expressions of gene constructs coding for the high potential iron-sulfur protein (HiPIP) from Chromatium vinosum D in Escherichia coli...
  76. Mayburd A, Kassner R. Mechanism and biological role of nitric oxide binding to cytochrome c'. Biochemistry. 2002;41:11582-91 pubmed
    The binding of nitric oxide to ferric and ferrous Chromatium vinosum cytochrome c' was studied. The extinction coefficients for the ferric and ferrous nitric oxide complexes were measured...
  77. Bertsch M, Kassner R. Selective staining of proteins with hydrophobic surface sites on a native electrophoretic gel. J Proteome Res. 2003;2:469-75 pubmed
    ..The application of these staining techniques may help elucidate new catalytic, transport, and regulatory functionalities in complex proteomic screenings. ..
  78. Smith E, Feinberg B. Redox properties of several bacterial ferredoxins using square wave voltammetry. J Biol Chem. 1990;265:14371-6 pubmed
    ..Fd was -385 mV; Clostridium pasteurianum, -393 mV; Clostridium thermosaccharolyticum, -408 mV; and Chromatium vinosum, -460 mV versus normal hydrogen electrode at 25 degrees C. The reduction potential of the C...
  79. Kerfeld C, Yeates T, Thornber J. Purification and characterization of the peripheral antenna of the purple-sulfur bacterium Chromatium purpuratum: evidence of an unusual pigment-protein composition. Biochemistry. 1994;33:2178-84 pubmed
    ..antenna and the preliminary characterization of a carotenoid-protein complex from the purple-sulfur bacterium Chromatium purpuratum are described. The peripheral antenna of C...
  80. Liu S, Steinbuchel A. Exploitation of butyrate kinase and phosphotransbutyrylase from Clostridium acetobutylicum for the in vitro biosynthesis of poly(hydroxyalkanoic acid). Appl Microbiol Biotechnol. 2000;53:545-52 pubmed
    ..In addition, the ability of the PHA synthase of Chromatium vinosum, PhaEC(Cv), to use these CoA thioesters was evaluated...
  81. Bertini I, Luchinat C, Niikura Y, Presenti C. Model-free analysis of a thermophilic Fe(7)S(8) protein compared with a mesophilic Fe(4)S(4) protein. Proteins. 2000;41:75-85 pubmed
    ..for the thermophilic Fe(7)S(8) protein from Bacillus schlegelii and for the Fe(4)S(4) HiPIP protein from Chromatium vinosum, which is a mesophilic protein. The investigation was performed at 276, 300, and 330 K at 11...
  82. Solov ev A, Makhneva Z, Erokhin Y. UV-Induced destruction of light-harvesting complexes from purple bacterium Chromatium minutissimum. Membr Cell Biol. 2001;14:463-74 pubmed
    ..a (Bchl a) from chromatophores and light harvesting complexes (LHC) of the sulphur photosynthetic bacterium Chromatium minutissimum...
  83. Oudart Y, Artero V, Pécaut J, Fontecave M. [Ni(xbsms)Ru(CO)2Cl2]: a bioinspired nickel-ruthenium functional model of [NiFe] hydrogenase. Inorg Chem. 2006;45:4334-6 pubmed
    ..This complex catalyzes hydrogen evolution by electroreduction of the weakly acidic Et3NH+ ions in N,N-dimethylformamide and is therefore the first functional bioinspired model of [NiFe] hydrogenases. ..
  84. Van Petegem F, De Vos D, Savvides S, Vergauwen B, Van Beeumen J. Understanding nicotinamide dinucleotide cofactor and substrate specificity in class I flavoprotein disulfide oxidoreductases: crystallographic analysis of a glutathione amide reductase. J Mol Biol. 2007;374:883-9 pubmed
    ..Herein, we present the crystal structure of the Chromatium gracile glutathione amide reductase (GAR) both alone and in complex with NAD(+)...
  85. Torres Ruiz J, McFadden B. Purification and characterization of chaperonin 10 from Chromatium vinosum. Arch Biochem Biophys. 1992;295:172-9 pubmed
    b>Chromatium vinosum contains a polypeptide that is functionally and structurally similar to the Escherichia coli chaperonin 10...
  86. Avissar Y, Ormerod J, Beale S. Distribution of delta-aminolevulinic acid biosynthetic pathways among phototrophic bacterial groups. Arch Microbiol. 1989;151:513-9 pubmed
    ..The five-carbon pathway is apparently the more widely utilized one among bacteria, while the ALA synthase pathway seems to be limited to the alpha subgroup of purple bacteria...
  87. Moulis J, Scherrer N, Gagnon J, Forest E, Petillot Y, Garcia D. Primary structure of Chromatium tepidum high-potential iron-sulfur protein in relation to thermal denaturation. Arch Biochem Biophys. 1993;305:186-92 pubmed
    A high-potential ferredoxin (HiPIP) has been purified from the thermophilic purple sulfur bacterium Chromatium tepidum...
  88. Nitschke W, Jubault Bregler M, Rutherford A. The reaction center associated tetraheme cytochrome subunit from Chromatium vinosum revisited: a reexamination of its EPR properties. Biochemistry. 1993;32:8871-9 pubmed
    The heme components of chromatophore membranes from the purple bacterium Chromatium vinosum have been studied by EPR...
  89. Samyn B, De Smet L, Van Driessche G, Meyer T, Bartsch R, Cusanovich M, et al. A high-potential soluble cytochrome c-551 from the purple phototrophic bacterium Chromatium vinosum is homologous to cytochrome c8 from denitrifying pseudomonads. Eur J Biochem. 1996;236:689-96 pubmed
    A minor cytochrome c-551 component of Chromatium vinosum was previously found to efficiently couple electron transfer between the cytochrome bc1 complex and the photosynthetic reaction center...
  90. Ivancich A, Kobayashi M, Drepper F, Fathir I, Saito T, Nozawa T, et al. Hydrogen-bond interactions of the primary donor of the photosynthetic purple sulfur bacterium Chromatium tepidum. Biochemistry. 1996;35:10529-38 pubmed
    ..the primary electron donor, P, in the reaction center (RC) from the thermophilic purple sulfur bacterium Chromatium tepidum. In addition, we report the alignment of partial sequences of the L and M protein subunits of C...
  91. Foster M, Bian S, Surerus K, Cowan J. Elucidation of a [4Fe-4S] cluster degradation pathway: rapid kinetic studies of the degradation of Chromatium vinosum HiPIP. J Biol Inorg Chem. 2001;6:266-74 pubmed
    Irreversible disassembly of the 4Fe-4S cluster in Chromatium vinosum high-potential iron protein (HiPIP) has been investigated in the presence of a low concentration of guanidinium hydrochloride...
  92. Kümmerle R, Gaillard J, Kyritsis P, Moulis J. Intramolecular electron transfer in [4Fe-4S] proteins: estimates of the reorganization energy and electronic coupling in Chromatium vinosum ferredoxin. J Biol Inorg Chem. 2001;6:446-51 pubmed
    ..The recent discovery that 2[4Fe-4S] proteins homologous to Chromatium vinosum ferredoxin contain clusters with different reduction potentials now gives the opportunity to study the ..